PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM03G34520.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WRKY
Protein Properties Length: 186aa    MW: 19578.2 Da    PI: 8.3464
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM03G34520.4genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY54.91.8e-1722602159
                     -EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY 21 prsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                     p sYYrCt ++C+vkk+vers++dp+vv++tYeg+H h+
  OGLUM03G34520.4 22 PTSYYRCTNSKCTVKKRVERSSDDPSVVITTYEGQHCHH 60
                     88**********************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031061.0E-122260IPR003657WRKY domain
PROSITE profilePS5081116.6042262IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.0E-152261IPR003657WRKY domain
SMARTSM007742.0E-82261IPR003657WRKY domain
SuperFamilySSF1182908.63E-142261IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MSTTTTSIAG HLRAITAMVG PPTSYYRCTN SKCTVKKRVE RSSDDPSVVI TTYEGQHCHH  60
TASFQRGVGG AAVAAHIHGA AAVALAEQMS AFVSPPPQPH MLYGLPRLHP PSSSETAVSC  120
SMPTTTSLQE LNNGEGLQRP GYNNSPQAAV TIAQRPPSPS VPPAVSFDKG LLDDIVPPGI  180
TKTFFV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126110.0CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631421.11e-99PREDICTED: probable WRKY transcription factor 57
RefseqXP_015631422.11e-99PREDICTED: probable WRKY transcription factor 57
TrEMBLA0A0D9ZDE81e-135A0A0D9ZDE8_9ORYZ; Uncharacterized protein
STRINGORGLA03G0318300.11e-101(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.23e-22WRKY DNA-binding protein 57